PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g046067m
Common NameCISIN_1g046067mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 522aa    MW: 58052.5 Da    PI: 5.6219
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g046067mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS53.16.1e-17175245171
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetse 71 
                        l+elL +cA+a++++d+ +a++l+a+ ++++s +gdp+qRl ay++e+L arla+s+s++ykal+++et++
  orange1.1g046067m 175 LKELLCACAKAIENNDMYAAESLMAESRQMVSVSGDPIQRLGAYMLEGLIARLASSGSSIYKALRCKETAT 245
                        5799***************************************************************9975 PP

2GRAS352.95e-10824452197374
               GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                        ++N aI ea++ e+++HiiDf i qG QW+ L+ aLasRp+gpp++RiTg++++++   +   le +g+rL+k+A+  +vpfefn+ +a + 
  orange1.1g046067m 244 ATNGAIAEAMKDENKIHIIDFLIAQGSQWIILIMALASRPGGPPHIRITGIDDSTAAyaRGGGLEIVGQRLSKLADLYKVPFEFNA-AAISG 334
                        79***************************************************888899999************************.8999* PP

               GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                        ++++le+L+v+pgEalaVn++++lh+++desvs++++rd++L+lvk+lsPkvv++veqea++n+++F++rfle++++y a+fds+++ lpr+
  orange1.1g046067m 335 SEVQLENLEVRPGEALAVNFSMMLHHMPDESVSIQNHRDRLLRLVKGLSPKVVTLVEQEANTNTAPFFHRFLETMNHYGAIFDSIDVALPRD 426
                        ******************************************************************************************** PP

               GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                        s++ri+vE+++l+reivn++acegaer+erhe ++kWr+r+ +aGF+p+pls ++++++k+ll++++ d y++ee++g+l+lgWk++++++ 
  orange1.1g046067m 427 SKDRINVEQHCLAREIVNLIACEGAERVERHEPFGKWRSRFIMAGFTPYPLSPFVNATIKTLLENYN-DNYTLEERDGALFLGWKNQAIIVS 517
                        *******************************************************************.55********************** PP

               GRAS 371 SaWr 374
                        SaWr
  orange1.1g046067m 518 SAWR 521
                        ***8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.548149502IPR005202Transcription factor GRAS
PfamPF035141.7E-105244521IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MQFSRMHKMS DGTQKFYDQP VQKLASKNWP PHQNIDHQPS SDDSNERARL SVDTFEQYCT  60
LESSSGTGSH GAPNSPSTAS FSPEKTQVSW PNQQSYSSEL YQSPDRTCGS PVSGSCITQN  120
ENDLRHKLRE LETVMLGPDL DTPAMYNVTS PKEDQISSES ERWKCLVEII SRGDLKELLC  180
ACAKAIENND MYAAESLMAE SRQMVSVSGD PIQRLGAYML EGLIARLASS GSSIYKALRC  240
KETATNGAIA EAMKDENKIH IIDFLIAQGS QWIILIMALA SRPGGPPHIR ITGIDDSTAA  300
YARGGGLEIV GQRLSKLADL YKVPFEFNAA AISGSEVQLE NLEVRPGEAL AVNFSMMLHH  360
MPDESVSIQN HRDRLLRLVK GLSPKVVTLV EQEANTNTAP FFHRFLETMN HYGAIFDSID  420
VALPRDSKDR INVEQHCLAR EIVNLIACEG AERVERHEPF GKWRSRFIMA GFTPYPLSPF  480
VNATIKTLLE NYNDNYTLEE RDGALFLGWK NQAIIVSSAW R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-551795218375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF4406470.0JF440647.1 Citrus medica var. sarcodactylis GRAS family transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006474942.10.0PREDICTED: scarecrow-like transcription factor PAT1 isoform X1
RefseqXP_015384708.10.0PREDICTED: scarecrow-like transcription factor PAT1 isoform X1
SwissprotQ8H1250.0SCL5_ARATH; Scarecrow-like protein 5
TrEMBLA0A067F4C70.0A0A067F4C7_CITSI; Uncharacterized protein
STRINGPOPTR_0001s37270.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62128141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.10.0scarecrow-like 5